NHG richtlijn

NHG-Standaard Aspecifieke lagerugpijn (tweede herziening)

0 reacties
Gepubliceerd
2 februari 2017
Belangrijkste wijzigingen
  • Voor het bepalen van het beleid is de indeling op basis van de duur van de klachten in acuut, subacuut en chronisch komen te vervallen.
  • Bij de behandeling zijn, naast de duur en de ernst van de klachten, ook de reactie op eerdere behandeling(en), de motivatie van de patiënt en de aanwezigheid van psychosociale risicofactoren die mogelijk een rol spelen bij een chronisch beloop van de klachten, van belang.
  • Leidraad voor de behandeling is een stappenplan dat bestaat uit voorlichting en advies, opbouw van activiteiten, oefentherapie, gedragsmatige behandeling en multidisciplinaire revalidatie.
  • Analgetica worden alleen geadviseerd ter ondersteuning van het activerende beleid.

Kernboodschappen
  • Houd rekening met een specifieke oorzaak van de rugpijn bij klachten die niet passen bij het normale patroon van aspecifieke lagerugpijn en bij een onverklaarbaar langdurig of progressief beloop.
  • Beeldvormende diagnostiek bij aspecifieke lagerugpijn wordt niet aanbevolen.
  • Het beleid is gericht op het bevorderen van bewegen en het oppakken of continueren van activiteiten (inclusief werk).
  • Informeer bij frequent recidiveren en/of onvoldoende verbeteren van de klachten na drie tot vier weken naar de aanwezigheid van factoren die mogelijk een rol spelen bij een chronisch beloop.

Na publicatie in H&W worden er soms nog wijzigingen doorgevoerd in de NHG-Standaard. Zie voor de meest recente versie www.nhg.org/standaarden

Inbreng van de patiënt

De NHG-Standaarden geven richtlijnen voor het handelen van de huisarts; de rol van de huisarts staat dan ook centraal. Daarbij geldt echter altijd dat factoren van de kant van de patiënt het beleid mede bepalen. Om praktische redenen komt dit uitgangspunt niet telkens opnieuw in de richtlijn aan de orde, maar wordt het hier expliciet vermeld. De huisarts stelt waar mogelijk het beleid vast in samenspraak met de patiënt, met inachtneming van diens specifieke omstandigheden en met erkenning van diens eigen verantwoordelijkheid, waarbij adequate voorlichting een voorwaarde is.

Afweging door de huisarts

Het persoonlijk inzicht van de huisarts is uiteraard bij alle richtlijnen een belangrijk aspect. Afweging van de relevante factoren in de concrete situatie zal beredeneerd afwijken van het hierna beschreven beleid kunnen rechtvaardigen. Dat laat onverlet dat deze standaard bedoeld is om te fungeren als maat en houvast.

Delegeren van taken

NHG-Standaarden bevatten richtlijnen voor huisartsen. Dit betekent niet dat de huisarts alle genoemde taken persoonlijk moet verrichten. Sommige taken kunnen worden gedelegeerd aan de praktijkassistente, praktijkondersteuner of praktijkverpleegkundige, mits zij worden ondersteund door duidelijke werkafspraken, waarin wordt vastgelegd in welke situaties de huisarts moet worden geraadpleegd en mits de huisarts toeziet op de kwaliteit. Omdat de feitelijke keuze van de te delegeren taken sterk afhankelijk is van de lokale situatie, bevatten de standaarden daarvoor geen concrete aanbevelingen.

Inleiding

De NHG-Standaard Aspecifieke lagerugpijn geeft aanbevelingen voor de diagnostiek en het beleid bij aspecifieke lagerugpijn. Onder aspecifieke lagerugpijn wordt rugpijn verstaan in het gebied tussen de onderste ribben en de bilplooien, waarbij geen specifieke lichamelijke oorzaak aanwijsbaar is. Dit kan gepaard gaan met stijfheid, spierspanning en uitstraling in de benen. Van alle gevallen van acute lagerugpijn is circa 95% aspecifiek.
De standaard geeft aan in welke gevallen rekening moet worden gehouden met een specifieke oorzaak van de klachten, zoals een maligniteit, wervelfractuur of axiale spondyloartritis. De behandeling van specifieke oorzaken van rugpijn valt echter buiten het bestek van deze standaard. Voor de diagnostiek bij rugpijn met uitstraling in een been wordt verwezen naar de NHG-Standaard Lumbosacraal radiculair syndroom. Tijdens en na de zwangerschap komt pijn rond het bekken en de lage rug frequent voor, zie hiervoor de NHG-Standaard Zwangerschap en kraamperiode.
Deze standaard bevat landelijke samenwerkingswerkingsafspraken die tot stand zijn gekomen in samenspraak met de Nederlandse Orthopaedische Vereniging (NOV), het Koninklijk Nederlands Genootschap voor Fysiotherapie (KNGF) en de Vereniging van Oefentherapeuten Cesar en Mensendieck (VvOCM). De standaard sluit aan bij de Ketenzorgrichtlijn Aspecifieke Lage Rugklachten (2010) van het Koninklijk Nederlands Genootschap voor Fysiotherapie (KNGF), het Nederlands Huisartsen Genootschap (NHG), de Nederlandse Orthopaedische Vereniging (NOV), de Nederlandse Vereniging voor Arbeids- en Bedrijfsgeneeskunde (NVAB) en het Kwaliteitsinstituut voor de gezondheidszorg CBO.
Bij de vertaling naar concrete aanbevelingen voor de huisarts is rekening gehouden met de diagnostische en therapeutische mogelijkheden en werkwijze in de eerste lijn.

Achtergronden

Epidemiologie

Lagerugpijn komt frequent voor. Van de westerse bevolking maakt 60 tot 90% ten minste één keer in het leven een episode door met aspecifieke lagerugpijn. De incidentie van lagerugpijn in de huisartsenpraktijk bedraagt 40,9 per 1000 patiënten per jaar (ICPC-code lage-rugpijn zonder uitstraling, 2012). De prevalentie van lagerugpijn (zonder uitstraling) in de huisartsenpraktijk bedraagt 38,5 per 1000 patiënten. In een deel van de gevallen zal aspecifieke lagerugpijn onder de ICPC-code ‘lage-rugpijn met uitstraling’ en ‘rug symptomen/klachten’ worden geregistreerd. Daarom zijn de incidentie- en prevalentiecijfers van aspecifieke lagerugpijn naar alle waarschijnlijkheid hoger dan de hierboven vermelde cijfers voor lagerugpijn zonder uitstraling. Daarnaast is de prevalentie in de open bevolking hoger; ongeveer de helft van de patiënten met rugpijn bezoekt met deze klachten de huisarts. De incidentie en prevalentie stijgen met de leeftijd. Vrouwen hebben vaker lagerugpijn dan mannen.1
Aspecifieke lagerugpijn gaat gepaard met een hoge ziektelast en leidt tot hoge maatschappelijke kosten, vooral vanwege ziekteverzuim en arbeidsongeschiktheid.2

Pathofysiologie

Bij acute lagerugpijn is in circa 95% van de gevallen geen specifieke lichamelijke oorzaak aanwijsbaar. Een veelgehanteerde hypothese is dat aspecifieke lagerugpijn te maken heeft met overbelasting van pijngevoelige structuren in en rond de wervelkolom, zoals tussenwervelschijven, gewrichten, zenuwen en spieren.
Bevindingen bij beeldvormend onderzoek, zoals standsafwijkingen of degeneratieve veranderingen, lijken – althans wat betreft de niet-ernstige vormen daarvan – geen relatie te hebben met lagerugpijn (zie ook de paragraaf Aanvullende diagnostiek). Ook is er geen onderbouwing voor en consensus over een classificatie op basis van bevindingen bij lichamelijk onderzoek, zoals verschuivingen van facetgewrichten en/of wervels en pijn bij het SI-gewricht, en is er onvoldoende onderbouwing voor op deze werkhypothesen gebaseerde behandelingen. Over het algemeen is het bij lagerugpijn, bij afwezigheid van risicofactoren of kenmerken die op een specifieke oorzaak wijzen (zie Evaluatie), dan ook niet noodzakelijk om een precieze oorzaak of diagnose vast te stellen om een adequate behandeling te starten.3

Risicofactoren

Risicofactoren voor het ontstaan van aspecifieke lagerugpijn

Factoren die geassocieerd zijn met het ontstaan van aspecifieke lagerugpijn zijn obesitas, werkgerelateerde psychosociale stressoren (zoals het verrichten van monotoon werk en veel werkstress), het verrichten van zwaar lichamelijk werk, lang autorijden, veel tillen en het veelvuldig draaien en buigen van de romp.4

Risicofactoren voor een chronisch beloop van aspecifieke lagerugpijn

Demografische factoren hebben waarschijnlijk geen invloed op het ontstaan van chronische klachten. Mogelijk zijn een ernstige functionele beperking, pijn in het been of radiculopathie, psychiatrische comorbiditeit en een slechte algehele gezondheid wel geassocieerd met een chronisch beloop.
De psychische en sociale factoren die waarschijnlijk een rol spelen bij het ontstaan van een chronisch beloop van aspecifieke lagerugpijn worden in de internationale literatuur yellow flags genoemd. Zo gaat lagerugpijn soms gepaard met angst voor pijn en bewegen en ongerustheid over het beloop. Ook een passieve copingstijl, aanwezigheid van depressieve gevoelens en psychische stress belemmeren waarschijnlijk het herstel.5 Een screeningsinstrument om patiënten met een hoog risico op een chronisch beloop te identificeren en de behandeling hierop te baseren, lijkt (vooralsnog) niet zinvol.6

Natuurlijk beloop

Bij aspecifieke lagerugpijn nemen de pijn en beperkingen in de meeste gevallen binnen een maand af. Naar schatting ontwikkelt circa 25-50% van de patiënten, in meer of mindere mate, chronische klachten (klachtenduur ≥ 12 weken). Bij deze patiënten is de kans op herstel kleiner. Meer dan 50% van de patiënten met aspecifieke lagerugpijn maakt in het jaar volgend op een eerdere episode een recidief door.7

Klinisch beeld

Bij aspecifieke lagerugpijn is de pijn gelokaliseerd in het gebied tussen de onderste ribben en de bilplooien. De pijn is over het algemeen diffuus en zeurend van karakter en gaat vaak gepaard met stijfheid, met name na rust. De klachten zijn meestal houdingsgerelateerd. Soms is er sprake van pijn in één of beide (boven)benen. Over het algemeen staat de rugpijn meer op de voorgrond dan de eventuele uitstraling in de benen.

Richtlijnen diagnostiek

De diagnostiek bij lagerugpijn is gericht op het verkrijgen van een indruk van de ernst van de pijn, het ziektegedrag en de beperkingen in fysiek functioneren en de dagelijkse werkzaamheden. Bij klachten of verschijnselen die niet passen bij het normale klachtenpatroon en/of een onverklaarbaar langdurig of progressief beloop, wordt nagegaan of er symptomen zijn die wijzen op een specifieke oorzaak van de rugpijn. Daarnaast is men alert op de aanwezigheid van factoren die geassocieerd zijn met een chronisch beloop van de rugpijn. Voor de diagnostiek bij uitstraling in een been (en het maken van een onderscheid tussen radiculaire en niet-radiculaire pijn) wordt verwezen naar de NHG-Standaard Lumbosacraal radiculair syndroom.

Spoed bij lagerugpijn

  • Beoordeel de klinische stabiliteit van de patiënt volgens de ABCDE-systematiek.
  • Wees alert op een ruptuur van een aneurysma aortae abdominalis bij:
      • leeftijd > 40 jaar;
      • acuut hevige pijn onafhankelijk van bewegen of houding;
      • een voorgeschiedenis met aneurysma aortae abdominalis;
      • aanwijzingen voor een bedreigde circulatie (duizeligheid, transpireren, gevoel van flauwvallen).
  • Wees alert op een cauda-equinasyndroom bij:
      • (uni- of bilaterale) motorische en/of sensibele uitval (rijbroekanesthesie);
      • hevige radiculaire pijn;
      • urineretentie en/of incontinentie voor urine en/of feces;
      • recente ingreep aan de rug (
      • Verwijs met spoed bij vermoeden van een geruptureerd aneurysma aortae abdominalis, een cauda-equinasyndroom of een toename van de pijn en/of uitvalsverschijnselen na een recente ingreep aan de rug.

Anamnese

Afhankelijk van de klachten van de patiënt en de differentieel-diagnostische overwegingen zijn de verdere anamnese en lichamelijk onderzoek meer of minder uitgebreid.
Vraag naar:
  • duur, wijze van ontstaan en beloop van de klachten;
  • voorafgaand trauma;
  • lokalisatie, uitstraling, aard en intensiteit van de pijn;
  • invloed van rust, beweging en houding op de klachten;
  • maligniteit in de voorgeschiedenis;
  • de mate van belemmering in het dagelijks functioneren thuis, op het werk (bijvoorbeeld verzuim of productiviteitsverlies), op school en in de vrije tijd;
  • de relatie van de klachten met de arbeidssituatie (invloed van klachten op het werk of andersom), contact met de bedrijfsarts;
  • eerdere episodes met lagerugpijn, het beloopBeloop en de behandeling;
  • zelfzorgZelfzorg en behandeling tot nu toe;
  • de ideeën die bij de patiënt leven over het ontstaan en voortbestaan van de klachten;
  • zorgen, ongerustheid, specifieke vragen en verwachtingen van de patiënt.

Vraag naar klachten die op een specifieke oorzaak van de rugpijn kunnen wijzen bij hevige pijn, een maligniteit in de voorgeschiedenis, een recente ingreep aan de wervelkolom en/of in geval van een onverklaarbaar langdurig of progressief beloop, zoals (zie ook [tabel 1]):
  • algehele malaise, onverklaard gewichtsverlies, koorts, nachtzweten;
  • krachtverliesKrachtverlies, sensibiliteitsstoornissenSensibiliteitsstoornissen, mictieklachtenMictieklachten;
  • uveïtis anteriorUveïtis anterior, perifere artritisPerifere artritis, enthesitisEnthesitis, psoriasis vulgarisPsoriasis vulgaris, inflammatoire darmaandoeningInflammatoire darmaandoening, familiair voorkomen van spondyloartritisfamiliair voorkomen van spondyloartritis;
  • recente ingreep aan de lumbale wervelkolom (zoals operatie, lumbaalpunctieLumbaalpunctie of epidurale steroïdinjectieEpidurale steroïdinjectie).

Ga na of er sprake is van factoren die mogelijk een rol spelen bij een chronisch beloop van de klachten (herstelbelemmerende factoren) bij een klachtenduur van drie tot vier weken of bij frequent recidiveren:
  • in toenemende mate ervaren van functionele beperkingen;
  • andere lichamelijke klachten;
  • angst voor pijn en letsel bij bewegen;
  • vermijden van belasting of beweging, of ander vermijdingsgedrag;
  • gevoelens van hulpeloosheid, machteloosheid (‘ik kan niets’, ‘ik kan er niets aan doen’);
  • fixatie op een mogelijk ernstige lichamelijke afwijking als verklaring van de klachten;
  • vragen om meer en specialistisch onderzoek;
  • veelvuldige behandelingen zonder effect of met veel neveneffecten;
  • ongerustheid over het beloop;
  • werkverzuim of werkloosheid;
  • lage werktevredenheid;
  • psychische stress, angststoornis of depressie.

Lichamelijk onderzoek

Onderzoek hoe de patiënt beweegt om een indruk te krijgen van de mate van bewegingsbeperking en ernst van de klachten, lokaliseer de pijn en let op ernstige houdingsafwijkingen.8
Verricht verder lichamelijk onderzoek bij vermoeden van een specifieke oorzaak van de klachten, aan de hand van [tabel 1].

Aanvullend onderzoek

Beeldvormende diagnostiek bij aspecifieke lagerugpijn wordt niet aanbevolen.9
De belangrijkste argumenten hiervoor zijn het ontbreken van een duidelijk verband tussen (degeneratieve) afwijkingen van de wervelkolom (bijvoorbeeld van de facetgewrichten of disci) die zichtbaar zijn bij beeldvorming en aspecifieke lagerugpijn. Daarnaast worden er geen therapeutische consequenties verbonden aan deze bevindingen en heeft het verrichten van beeldvormend onderzoek geen gunstige invloed op het beloop (geen afname in pijn of functionaliteit op de korte of lange termijn). Eventuele bevindingen kunnen leiden tot een onjuiste ziektebeleving en onnodige behandelingen.
Het verrichten van röntgen- en CT-diagnostiekRöntgen- en CT-diagnostiek van de lage rug gaat bovendien gepaard met een stralenbelasting in het gebied van de geslachtsorganen.
Bij vermoeden van een wervelfractuur is röntgendiagnostiek van de thoracale en/of lumbale wervelkolom wel zinvol (zie NHG-Standaard Fractuurpreventie).
Zie voor de diagnostiek bij vermoeden van een metastase van een prostaatcarcinoom de NHG-Standaard Mictieklachten bij mannenMictieklachten bij mannen.
Bij vermoeden van andere specifieke oorzaken (zoals een maligniteit of axiale spondyloartritis) wordt laboratoriumonderzoekLaboratoriumonderzoek en/of röntgendiagnostiek in de eerste lijn niet aanbevolen. Deze onderzoeken zijn onvoldoende sensitief om deze specifieke oorzaken, bij niet-afwijkende bevindingen, met zekerheid uit te kunnen sluiten.10,11

Evaluatie

Ga na of er aanwijzingen zijn voor een specifieke lichamelijke oorzaak Specifieke lichamelijke oorzaak (circa 5%) aan de hand van [tabel 1]. De aanwezigheid van een enkel kenmerk hoeft niet direct op een specifieke oorzaak te wijzen; een combinatie van meerdere kenmerken, zeker bij een onverklaarbaar langdurig, hevig of progressief beloop, vergroot de waarschijnlijkheid dat de pijnklachten door een specifieke aandoening worden veroorzaakt. Verwijs patiënten met vermoeden van een specifieke oorzaak van de klachten (zie Consultatie/verwijzing).11
Stel de diagnose aspecifieke lagerugpijn (circa 95%) bij rugpijn in het gebied tussen de onderste ribben en de bilplooien indien een specifieke oorzaak onwaarschijnlijk is.
Overige differentieel-diagnostische overwegingen zijn abdominale aandoeningen (bijvoorbeeld appendicitisAppendicitis, cystitisCystitis) en heuppathologieHeuppathologie (bijvoorbeeld coxartroseCoxartrose). Deze aandoeningen kunnen gepaard gaan en/of zich presenteren met lagerugpijn. Het beleid bij deze aandoeningen valt buiten het bestek van deze standaard.
De aanwezigheid van een enkel kenmerk hoeft niet direct op een specifieke oorzaak te wijzen; een combinatie van meerdere kenmerken, zeker bij een onverklaarbaar langdurig of progressief beloop, vergroot de waarschijnlijkheid dat de pijnklachten door een specifieke aandoening worden veroorzaakt. Zie voor kenmerken van een lumbosacraal radiculair syndroom of cauda-equinasyndroom de NHG-Standaard Lumbosacraal radiculair syndroom.
Tabel
AandoeningRisicofactoren/kenmerken
Maligniteit (wervelmetastasen of leptomeningeale metastasen)
  • Maligniteit in de voorgeschiedenis (vooral mamma-, prostaat- en longcarcinoom)
  • Leeftijd > 50 jaar
  • Continue pijn, onafhankelijk van houding of bewegen
  • Nachtelijke verergering van de pijn
  • Neurologische uitvalsverschijnselen, vaak bilateraal
  • Algehele malaise, nachtzweten
  • Onverklaard gewichtsverlies
Wervelfractuur (traumatisch of spontaan)(zie NHG-Standaard Fractuurpreventie)
  • Leeftijd > 65 jaar
  • Vrouwelijk geslacht
  • Klachten aansluitend aan een hoogenergetisch trauma
  • Langdurig gebruik van corticosteroïden
  • Postuurverandering (versterkte thoracale kyfose)
  • Lengtevermindering
  • Plotseling ontstaan van de klachten
  • Laag lichaamsgewicht
  • Heupfracturen bij ouders
Axiale spondyloartritis
  • Ontstaan van lagerugpijn voor 45e levensjaar
  • Klachtenduur > 3 maanden (bijna dagelijks)
  • Geleidelijk ontstaan van de klachten
  • Nachtelijke pijn (met verbetering na het opstaan)
  • Minder pijn en stijfheid bij bewegen
  • Geen verbetering in rust; ochtendstijfheid
  • Sterke verbetering van de pijn na gebruik van NSAID’s
  • Verstreken lumbale lordose (klachtenduur > 10 jaar), toegenomen thoracale kyfose in combinatie met verminderde beweeglijkheid wervelkolom
  • Voorgeschiedenis/positieve familieanamnese: uveïtis anterior, psoriasis vulgaris, onverklaarde perifere artritis of enthesitis, dactylitis, inflammatoire darmaandoening
Spondylolisthesis
  • Begin van lagerugpijn voor 20e levensjaar
  • Palpabel trapje in verloop van processi spinosi laag lumbaal
  • Neurologische uitvalsverschijnselen
Spondylodiscitis/epiduraal abces
  • Onvoldoende reactie op (hoog gedoseerde) pijnmedicatie
  • Snel progressieve neurologische uitval
  • Koorts, koude rillingen, nachtzweten
  • Onverklaard gewichtsverlies
  • Intraveneus drugsgebruik
  • Comorbiditeit: immuuncompromitterende aandoeningen15
  • Recente rugoperatie, epidurale injectie, lumbaalpunctie of zenuwwortelblokkade
Spinaal epiduraal hematoom
  • Stollingsstoornis of gebruik orale anticoagulantia
  • Snel progressieve neurologische uitvalsverschijnselen
  • Recente rugoperatie, epidurale injectie, lumbaalpunctie of zenuwwortelblokkade

Richtlijnen beleid

Het beleid bij aspecifieke lagerugpijn bestaat uit voorlichting, begeleiding en maatregelen tot behoud of herstel van het dagelijks functioneren. Daarnaast is er aandacht voor eventuele pijnbestrijding. Het beleid wordt in samenspraak met de patiënt opgesteld op basis van onder andere motivatie, comorbiditeit, ernst van de klachten, klachtenduur en eventuele eerdere ervaringen.
Het belangrijkste doel van dit beleid is te bevorderen dat de patiënt in beweging blijft of komt, zelfs bij veel pijn en hinder, en zo veel mogelijk normaal blijft functioneren wat betreft werk, huishouden, hobby’s en andere dagelijkse bezigheden. Dit is mede belangrijk om te voorkomen dat de klachten chronisch worden.
Gezien de grote kans op spontaan herstel bestaat het beleid gedurende de eerste weken vooral uit voorlichting en adviezen gericht op het weer oppakken en uitbreiden van de activiteiten. Indien de klachten binnen circa drie weken na het begin van de klachten niet of onvoldoende verbeteren, is intensivering van de behandeling gewenst.16 Een leidraad hiervoor is een stappenplan dat bestaat uit voorlichting, uitbreiding van activiteiten, oefentherapie, gedragsmatige behandeling en multidisciplinaire revalidatie.

Voorlichting en advies

Geef voorlichting en adviezen over de volgende punten.

Aard van de aandoening

Leg uit dat:
  • de precieze oorzaak van de lagerugpijn onbekend is. De oorzaak zit vermoedelijk in het geheel van spieren, banden en botten in de rug, dat tijdelijk niet optimaal functioneert. Dit kan niet zichtbaar worden gemaakt op een röntgenfotoRöntgenfoto.
  • pijn bij verandering van houding of bewegen niet verontrustend is en niet betekent dat er schade ontstaat.
  • rugpijn vaak voorkomt en meestal vanzelf binnen een aantal weken overgaat. Meer dan de helft van de patiënten krijgt binnen een jaar opnieuw klachten. Maar ook dan gaat de rugpijn vaak vanzelf weer over.

Mate van activiteiten

  • Adviseer in beweging te blijven en door te gaan met de dagelijkse activiteiten (inclusief werk).
  • Leg uit dat bedrustBedrust niet zinvol is. Adviseer bij ernstige klachten enkele dagen zo nu en dan voor enkele uren rust te nemen en daarna geleidelijk de normale activiteiten weer op te pakken, zelfs als de pijn nog steeds hevig is.17

Beeldvormende diagnostiek

  • Leg uit dat lagerugpijn, zonder aanwijzingen voor een specifieke oorzaak, geen reden is om beeldvormende diagnostiek te verrichten. De belangrijkste argumenten hiervoor zijn het ontbreken van een relatie tussen op de foto zichtbare afwijkingen met ervaren klachten en het ontbreken van consequenties voor het beleid (zie Aanvullende diagnostiek).

Behandeling

Leg uit dat:
  • gezien de grote kans op spontaan herstelSpontaan herstel de behandeling bestaat uit het geven van voorlichting en adviezen gedurende de eerste weken. Bij hevige pijn kan medicamenteuze pijnbestrijding worden overwogen, hoewel de werkzaamheid hiervan waarschijnlijk beperkt is.24
  • indien de klachten chronischChronisch zijn geworden, de nadruk bij de behandeling op het omgaan met de klachten en het dagelijks functioneren komt te liggen, in plaats van op het verdwijnen van de pijn (zie Niet-medicamenteuze behandeling).

Arbeidssituatie

  • Adviseer, als er (mogelijk) een relatie is met de arbeidssituatie of als er sprake is van werkverzuimWerkverzuim, contact op te nemen met de bedrijfsarts, indien dat nog niet is gebeurd (zie Consultatie/ verwijzing).

Bied voorlichtingsmateriaal aan en verwijs naar de informatie over aspecifieke lagerugpijn op www.thuisarts.nl. De informatie op www.thuisarts.nl is gebaseerd op deze NHG-Standaard.

Niet-medicamenteuze behandeling

Aanbevolen wordt om bij de behandeling onderstaand stappenplan als leidraad te nemen, waarbij over wordt gegaan naar de volgende stap indien de voorgaande stap tot onvoldoende verbetering van het functioneren heeft geleid.
Houd bij de keuze voor de behandeling en de snelheid van het doorlopen van het stappenplan niet alleen rekening met de duur en ernst van de klachten, maar ook met de reactie op eerdere behandelingen, de motivatie van de patiënt en de aanwezigheid van factoren die mogelijk een rol spelen bij een chronisch beloop.

Stap 1: Voorlichting en advies

  • Bespreek de punten zoals genoemd in de paragraaf Voorlichting en advies.
  • Geef extra aandacht aan patiënten die erg ongerust zijn om te bevorderen dat zij hun normale activiteiten weer oppakken. Bespreek bij het eerste contact hoe en wanneer bepaalde activiteiten kunnen worden hervat.

Stap 2: Opbouw van activiteiten

  • Overweeg het bewegen en oppakken van de activiteiten te bevorderen volgens een tijdcontingente aanpakTijdcontingente aanpak indien de klachten binnen circa drie tot vier weken na het begin van de klachten niet of onvoldoende zijn verbeterd. In het [kader] wordt een tijdcontingente aanpak toegelicht.
  • Bespreek in geval van bewegingsangstBewegingsangst of -armoedeBewegingsarmoede en als het de patiënt zelf niet lukt om de activiteiten uit te breiden, de mogelijkheid van verwijzing naar een fysio- of oefentherapeut ter begeleiding van de tijdcontingente opbouwTijdcontingente opbouw van de activiteiten.

Tijdcontingente aanpak

  • Stel in samenspraak met de patiënt een plan op voor een stapsgewijze, tijdcontingente uitbreiding van belasting en activiteiten, ongeacht de ervaren hinder. Zie onderstaand voorbeeld en de bijlage Persoonlijk activiteitenplan bij rugklachten (zie de webversie van deze standaard op www.nhg.org).
  • Spreek bij alle stappen in het schema vaste termijnen af.
  • De stappen naar herstel worden concreet gemaakt met concrete bewegingstips (zie ook www.thuisarts.nl); bespreek hoe de gegeven bewegingsadviezen of oefeningen kunnen aansluiten bij de ervaren belemmeringen in het dagelijks leven.

Voorbeeld tijdcontingente advisering
GEWENST: tijdcontingentONGEWENST: pijncontingent
BewegenBlijf bewegen en breid de activiteiten in circa veertien dagen uit naar normaal.Probeer te lopen als de pijn het toelaat.
Werk/dagelijkse activiteitenGa na circa een week weer aan het werk.Ga aan het werk zodra de pijn het toelaat of over is.
VerwijzingIk verwijs u naar de fysiotherapeut voor drie behandelingen. Voer in die periode onder diens begeleiding uw activiteiten geleidelijk op.Ik verwijs u voor behandeling naar een therapeut.
ControleKom na circa drie weken terug, tenzij u dan weer normaal functioneert.Als het niet gaat, komt u terug.

Stap 3: Oefentherapie

  • Bespreek, als de patiënt er niet in slaagt om met de tijdcontingente aanpak binnen drie weken (totale klachtenduur circa zes weken) de activiteiten uit te breiden tot normaal, de mogelijkheid van begeleiding door een fysio- of oefentherapeut.
  • Maak een keuze op basis van de voorkeuren en wensen van de patiënt; er wordt geen specifieke vorm van oefentherapie aanbevolen; een activerende en tijdcontingente aanpak heeft de voorkeur.18,19
  • ManipulatiesManipulaties als monotherapie (bijvoorbeeld osteopathieOsteopathie, chiropractieChiropractie) worden niet aanbevolen.20

Stap 4: Gedragsmatige behandeling

  • Bespreek, indien de klachten onvoldoende zijn afgenomen bij een klachtenduur van twaalf weken, de mogelijkheid tot het volgen van een gedragsmatige behandeling. Betrek daarbij de voorkeuren, wensen en motivatie van de patiënt. Overleg zo nodig met de therapeut uit stap 3.
  • Verwijs, indien voor deze behandeling wordt gekozen, de patiënt naar een therapeut met expertise op dit gebied, zoals een psychosomatisch fysioPsychosomatisch fysiotherapeut- of oefentherapeutPsychosomatisch oefentherapeut of een gespecialiseerde eerstelijnspsycholoogEerstelijnspsycholoog.21

Toelichting: de behandeling bestaat uit een cognitief-gedragstherapeutische benadering, gericht op het verhogen van het activiteitenniveau van de patiënt, het veranderen van disfunctionele gedachten (attributies en verwachtingen) en het aanleren van copingvaardigheden.

Stap 5: Multidisciplinaire revalidatie

  • Verwijs voldoende gemotiveerde patiënten met chronische klachten, waarbij oefentherapie en gedragsmatige behandeling onvoldoende effectief waren, naar een multidisciplinair revalidatieprogrammaMultidisciplinair revalidatieprogramma.
  • Verwijzing voor deze gespecialiseerde behandeling is vooral zinvol indien de patiënt nog niet is teruggekeerd in het arbeidsproces, er sprake is van een hoge ziektelast én er vermoedelijk psychosociale factorenPsychosociale factoren van invloed zijn op het in stand houden van de klachten.

Toelichting: deze behandeling bestaat uit een combinatie van educatieve, fysieke, gedragsmatige en/of arbeidsgerelateerde interventiesArbeidsgerelateerde interventies. Hierbij zijn verschillende disciplines, zoals een revalidatieartsRevalidatiearts, psycholoogPsycholoog en fysioFysiotherapeut- of oefentherapeutOefentherapeut, betrokken. De behandeling is gericht op het verbeteren van het functioneren van de patiënt en het beter leren omgaan met de rugpijn en wordt aangeboden in gespecialiseerde behandel-/revalidatiecentra.22
Bespreek met patiënten met chronische of steeds recidiverende klachtenRecidiverende klachten de wijze waarop de patiënt zelfstandig keuzes kan maken bij dagelijkse bezigheden die mogelijk beïnvloed worden door de rugpijn. Bespreek ook hoe de patiënt kan leren omgaan met de symptomen en lichamelijke, sociale en psychische gevolgen van de klachten. Hiertoe kan het opstellen van een individueel zorgplan bij sommige patiënten met chronische klachten behulpzaam zijn (zie de Handreiking Gezamenlijke besluitvorming over doelen en zorgafspraken op www.nhg.org/actueel/dossiers/dossier-persoonsgerichte-zorg).23
In geval van chronische klachtenChronische klachten, waarbij de aanpak volgens het stappenplan niet tot het beoogde resultaat heeft geleid, wordt verwezen naar de NHG-Standaarden Pijn en SOLK.

Medicamenteuze behandeling

Pijnmedicatie

Bespreek de mogelijkheid van analgeticaAnalgetica ter ondersteuning van het activerende beleid. De werkzaamheid van analgetica ten aanzien van pijn en functionaliteit bij aspecifieke lagerugpijn is waarschijnlijk beperkt. Schrijf de analgetica voor conform het stappenplan, zoals beschreven in de NHG-Standaard Pijn.24
De volgende aanbevelingen zijn specifiek van toepassing op de behandeling van patiënten met aspecifieke lagerugpijn:
  • ParacetamolParacetamol kan zowel tijdcontingent als naar behoefte worden voorgeschreven; er is geen verschil in effectiviteit.
  • NSAID’sNSAID’s zijn waarschijnlijk niet effectiever dan paracetamol bij lagerugpijn.
  • Dermale NSAID’sDermale NSAID’s, zoals diclofenacgelDiclofenacgel 1-3% of ibuprofengel 5%, kunnen als alternatief dienen voor orale NSAID’sOrale NSAID’s. Dermale varianten gaan minder vaak gepaard met systemische bijwerkingen en kunnen daardoor ook door ouderen met een verminderde nierfunctie of hartfalen gebruikt worden (mits de huid intact is).
  • Behandel alleen patiënten met hevige, acute lagerugpijn bij wie zwakker werkende analgetica niet effectief waren met opiatenOpiaten. Informeer de patiënt over de bijwerkingen en houd de behandelduur zo kort mogelijk (maximaal vijf dagen).
  • Behandel alleen patiënten met chronische aspecifieke lagerugpijn met ernstige beperkingen met zwak- of sterkwerkende opiatenSterkwerkende opiaten met als doel het stapsgewijs uitbreiden van activiteiten te ondersteunen. Houd in dit geval de behandelduur zo kort mogelijk, maximaal één tot twee weken.
  • Gebruik van neuropathische pijnmedicatieNeuropathische pijnmedicatie, zoals antidepressivaAntidepressiva en anti-epilepticaAnti-epileptica, ter vermindering van pijn, wordt niet aanbevolen.25,26

Benzodiazepinen

Benzodiazepinen worden niet aanbevolen. Een gunstig effect van de beoogde spierverslapping op de pijnklachten of functionaliteit is niet aangetoond, terwijl deze middelen wel bijwerkingen hebben en er kans op afhankelijkheid bestaat.27

Overige behandelingen

Anesthesiologische behandelingenAnesthesiologische behandelingen, zoals radiofrequente laesieRadiofrequente laesie (zenuwblokkade door hittebehandelingZenuwblokkade door hittebehandeling) of injecties met analgetica of corticosteroïdenCorticosteroïden (bijvoorbeeld ter plaatse van de facetgewrichtenFacetgewrichten of epiduraal), worden niet aanbevolen. De werkzaamheid bij aspecifieke lagerugpijn is niet aangetoond en de behandelingen kunnen gepaard gaan met complicaties.28,29
Operatieve behandelingenOperatieve behandelingen, zoals spondylodeseSpondylodese (lumbale fusieLumbale fusie) en het inbrengen van kunstdisciKunstdisci, worden niet aanbevolen, omdat een gunstig effect van deze ingrepen niet is aangetoond. Daarnaast is er risico op ernstige complicaties en onduidelijkheid over de langetermijneffecten.30

Controle

De frequentie van de controlesControles hangt af van de ernst van de klachten, de verwachte noodzaak tot evaluatie en bijstelling van de ingestelde behandeling en de behoefte van de patiënt. Een leidraad voor de frequentie van de controles is:
  • bij een sterke toename van de pijn en/of beperkingen: na een tot twee dagen;
  • bij aanhoudende hevige pijn: na één week;
  • bij de start van een nieuwe behandeling (stappenplan): na twee tot drie weken;
  • bij het niet of niet meer verbeteren van het functioneren: na drie weken.

Aandachtspunten bij de controle zijn:
  • Beloop: vervolg het beloop aan de hand van de pijn (eventueel met behulp van een pijnschaal) en de mate van (dis)functioneren. Herhaal, indien de klachten niet verbeteren, anamnese en lichamelijk onderzoek. Inventariseer herstelbelemmerende factoren in de omstandigheden of het gedrag van de patiënt, eventueel met behulp van het acroniem SCEGS (zie de NHG-Standaarden Pijn en SOLK). Blijf alert op een lumbosacraal radiculair syndroom of aanwijzingen voor een ernstige oorzaak van de klachten, vooral bij aanwezigheid van kenmerken zoals beschreven in [tabel 1] en bij een onverklaarbaar langdurig of progressief beloop.
  • Herstelbelemmerende factoren Herstelbelemmerende factoren: ga bij een klachtenduur van drie tot vier weken de aanwezigheid van psychosociale risicofactoren voor een chronisch beloop na (zie Anamnese).
  • Pijnbestrijding Pijnbestrijding : vraag naar de effectiviteit van eventuele medicatie, bijwerkingen en de invloed van medicatie op het dagelijks functioneren. Pas zo nodig de medicatie aan.
  • Arbeidssituatie Arbeidssituatie : vraag, indien van toepassing, naar arbeidsverzuim, contacten met de bedrijfsarts en naar eventuele belemmerende factoren voor werkhervatting.

Consultatie/verwijzing

Bij vermoeden van een specifieke oorzaak van de rugpijn:
  • Verwijs binnen één week naar een internist-oncoloogInternist-oncoloog of orthopedisch chirurgOrthopedisch chirurg:
      • patiënten met in de voorgeschiedenis een maligniteit en (een niet-bekende en onbegrepen) rugpijn;
      • bij vermoeden van een metastaseMetastase zonder bekende maligniteitMaligniteit.
  • Verwijs naar een reumatoloogReumatoloog:
      • bij vermoeden van axiale spondyloartritisAxiale spondyloartritis. Overleg bij twijfel over de indicatie of urgentie voor verwijzing met de desbetreffende specialist.
  • Verwijs naar een orthopedisch chirurg:
      • bij vermoeden van een andere specifieke oorzaak van de rugpijn. Overleg bij twijfel over de indicatie of urgentie voor verwijzing met de desbetreffende specialist.

Bij aspecifieke lagerugpijn:
  • Verwijs naar een fysio- of oefentherapeut, gedragsmatig therapeutGedragsmatig therapeut of een centrum voor multidisciplinaire revalidatie aan de hand van het stappenplan (zie Niet-medicamenteuze behandeling).
  • Verwijs de patiënt zo nodig naar de bedrijfsartsBedrijfsarts of neem zelf contact op met de bedrijfsarts (indien de patiënt daar toestemming voor geeft) indien:
      • er langdurige uitval is of wordt verwacht;
      • er belemmeringen zijn voor de uitvoering van het werk vanwege de klachten;
      • de patiënt van mening is dat de klachten (mede) zijn ontstaan of in stand worden gehouden door het werk;
      • er behoefte is aan aanpassing van de werkplek;
      • er behoefte is aan bedrijfsartsgeneeskundige expertise om op het werk (de gevolgen van) de klachten te duiden.

Verwijs bij aspecifieke lagerugpijn bij voorkeur niet naar een monodisciplinair werkzame specialist.

Organisatie van de zorg

Bij patiënten met chronische aspecifieke lagerugpijn is het belangrijk dat de zorg tussen de verschillende behandelaren wordt afgestemd om te voorkomen dat verschillende behandelingen naast elkaar plaatsvinden of patiënten langdurig uitvallen uit het arbeidsproces. Spreek daarom met bij chronische lagerugpijn betrokken disciplines, zoals bedrijfsarts en fysio- of oefentherapeut, op lokaal of regionaal niveau af wie bij verwijzing binnen de eerste lijn of naar de tweede lijn de behandeling coördineert en aanspreekpunt is voor patiënten en betrokken zorgverleners. Bepalend hiervoor zijn de beschikbaarheid en de benodigde deskundigheid.
Andere punten waarover lokaal of regionaal afspraken gemaakt kunnen worden, zijn: diagnostiek en behandeling, werkhervatting, samenwerking en communicatie (bijvoorbeeld over verwijzen en terugverwijzen, onderlinge uitwisseling van informatie en over de begeleiding van en voorlichting aan patiënten). Zie de samenwerkingsafspraken in de bijlage (zie de webversie van deze Standaard op www.nhg.org).

Totstandkoming en methoden

Zie voor het deel Totstandkoming en methoden de webversie van deze standaard op www.nhg.org.

Literatuur

  • 1.Bij verwijzingen naar NHG-producten: zie www.nhg.org.
  • 2.Alfieri A, Gazzeri R, Prell J, Rollinghoff M. The current management of lumbar spondylolisthesis. J Neurosurg Sci 2013;57:103-13.
  • 3.Anonymous. Ketenzorgrichtlijn aspecifieke lage rugklachten (2010). www.diliguide.nl/document/3272/file/pdf/.
  • 4.Ash LM, Modic MT, Obuchowski NA, Ross JS, Brant-Zawadzki MN, Grooff PN. Effects of diagnostic information, per se, on patient outcomes in acute radiculopathy and low back pain. AJNR Am J Neuroradiol 2008;29:1098-103.
  • 5.Ashworth J, Green DJ, Dunn KM, Jordan KP. Opioid use among low back pain patients in primary care: Is opioid prescription associated with disability at 6-month follow-up? Pain 2013;154:1038-44.
  • 6.Balthazard P, De Goumoens P, Rivier G, Demeulenaere P, Ballabeni P, Deriaz O. Manual therapy followed by specific active exercises versus a placebo followed by specific active exercises on the improvement of functional disability in patients with chronic non specific low back pain: A randomized controlled trial. BMC Musculoskelet Disord 2012;13:162.
  • 7.Braun A, Saracbasi E, Grifka J, Schnitker J, Braun J. Identifying patients with axial spondyloarthritis in primary care: How useful are items indicative of inflammatory back pain? Ann Rheum Dis 2011;70:1782-7.
  • 8.Carragee E, Alamin T, Cheng I, Franklin T, Van den Haak E, Hurwitz E. Are first-time episodes of serious LBP associated with new MRI findings? Spine J 2006;6:624-35.
  • 9.Cawston H, Davie A, Paget MA, Skljarevski V, Happich M. Efficacy of duloxetine versus alternative oral therapies: An indirect comparison of randomised clinical trials in chronic low back pain. Eur Spine J 2013;22:1996-2009.
  • 10.CBO Kwaliteitsinstituut voor de Gezondheidszorg. Richtlijn aspecifieke lage rugklachten. Alphen a/d Rijn: Van Zuiden Communications, 2003.
  • 11.Cecchi F, Molino-Lova R, Chiti M, Pasquini G, Paperini A, Conti AA, et al. Spinal manipulation compared with back school and with individually delivered physiotherapy for the treatment of chronic low back pain: A randomized trial with one-year follow-up. Clin Rehabil 2010;24:26-36.
  • 12.Chaparro LE, Furlan AD, Deshpande A, Mailis-Gagnon A, Atlas S, Turk DC. Opioids compared to placebo or other treatments for chronic low-back pain. Cochrane Database Syst Rev 2013;8:CD004959.
  • 13.Chou R, Huffman LH. Medications for acute and chronic low back pain: A review of the evidence for an american pain society/american college of physicians clinical practice guideline. Ann Intern Med 2007;147:505-14.
  • 14.Chou R, Fu R, Carrino JA, Deyo RA. Imaging strategies for low-back pain: Systematic review and meta-analysis. Lancet 2009;373:463-72.
  • 15.Chou R, Shekelle P. Will this patient develop persistent disabling low back pain? JAMA 2010;303:1295-302.
  • 16.Chou D, Samartzis D, Bellabarba C, Patel A, Luk KD, Kisser JM, et al. Degenerative magnetic resonance imaging changes in patients with chronic low back pain: A systematic review. Spine (Phila Pa 1976) 2011;36:S43-53.
  • 17.Chou R, Hashimoto R, Friedly J, Fu R, Dana T, Sullivan S, et al. Pain management injection therapies for low back pain (2015). AHRQ Technology assessment report. www.cms.gov/medicare/coverage/determinationprocess/downloads/id98ta.pdf
  • 18.Chung JW, Zeng Y, Wong TK. Drug therapy for the treatment of chronic nonspecific low back pain: Systematic review and meta-analysis. Pain Physician 2013;16:E685-704.
  • 19.Costa Lda C, Maher CG, McAuley JH, Hancock MJ, Herbert RD, Refshauge KM, et al. Prognosis for patients with chronic low back pain: Inception cohort study. BMJ 2009;339:b3829.
  • 20.Cramer H, Lauche R, Haller H, Dobos G. A systematic review and meta-analysis of yoga for low back pain. Clin J Pain 2013;29:450-60.
  • 21.Cruser A, Maurer D, Hensel K, Brown SK, White K, Stoll ST. A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel. J Man Manip Ther 2012;20:5-15.
  • 22.Dahm KT, Brurberg KG, Jamtvedt G, Hagen KB. Advice to rest in bed versus advice to stay active for acute low-back pain and sciatica. Cochrane Database Syst Rev 2010:CD007612.
  • 23.Davies RA, Maher CG, Hancock MJ. A systematic review of paracetamol for non-specific low back pain. Eur Spine J 2008;17:1423-30.
  • 24.Deyo RA, Rainville J, Kent DL. What can the history and physical examination tell us about low back pain? JAMA 1992;268:760-5.
  • 25.Deyo RA, Jarvik JG, Chou R. Low back pain in primary care. BMJ 2014;349:g4266.
  • 26.Di Iorio D, Henley E, Doughty A. A survey of primary care physician practice patterns and adherence to acute low back problem guidelines. Arch Fam Med 2000;9:1015-21.
  • 27.Downie A, Williams CM, Henschke N, Hancock MJ, Ostelo RW, De Vet HC, et al. Red flags to screen for malignancy and fracture in patients with low back pain: Systematic review. BMJ 2013;347:f7095.
  • 28.Ernst E. Adverse effects of spinal manipulation: A systematic review. J R Soc Med 2007;100:330-8.
  • 29.Franklin GM, Stover BD, Turner JA, Fulton-Kehoe D, Wickizer TM. Early opioid prescription and subsequent disability among workers with back injuries: The disability risk identification study cohort. Spine (Phila Pa 1976) 2008;33:199-204.
  • 30.Haas M, Vavrek D, Peterson D, Polissar N, Neradilek MB. Dose-response and efficacy of spinal manipulation for care of chronic low back pain: A randomized controlled trial. Spine J 2014;14:1106-16.
  • 31.Hayden JA, Van Tulder MW, Malmivaara A, Koes BW. Exercise therapy for treatment of non-specific low back pain. Cochrane Database Syst Rev 2005:CD000335.
  • 32.Hellum C, Johnsen LG, Storheim K, Nygaard OP, Brox JI, Rossvoll I, et al. Surgery with disc prosthesis versus rehabilitation in patients with low back pain and degenerative disc: Two year follow-up of randomised study. BMJ 2011;342:d2786.
  • 33.Heneweer H, Staes F, Aufdemkampe G, Van Rijn M, Vanhees L. Physical activity and low back pain: A systematic review of recent literature. Eur Spine J 2011;20:826-45.
  • 34.Henschke N, Maher CG, Refshauge KM, Herbert RD, Cumming RG, Bleasel J, et al. Prevalence of and screening for serious spinal pathology in patients presenting to primary care settings with acute low back pain. Arthritis Rheum 2009;60:3072-80.
  • 35.Henschke N, Ostelo RW, Van Tulder MW, Vlaeyen JW, Morley S, Assendelft WJ, et al. Behavioural treatment for chronic low-back pain. Cochrane Database Syst Rev 2010:CD002014.
  • 36.Heuch I, Heuch I, Hagen K, Zwart JA. Body mass index as a risk factor for developing chronic low back pain: A follow-up in the nord-trondelag health study. Spine (Phila Pa 1976.) 2013;38:133-9.
  • 37.Hill JC, Dunn KM, Lewis M, Mullis R, Main CJ, Foster NE, et al. A primary care back pain screening tool: Identifying patient subgroups for initial treatment. Arthritis Rheum 2008;59:632-41.
  • 38.Hill JC, Whitehurst DGT, Lewis M, Bryan S, Dunn KM, Foster NE, et al. Comparison of stratified primary care management for low back pain with current best practice (start back): A randomised controlled trial. Lancet 2011;378:1560-71.
  • 39.Hoy D, March L, Brooks P, Blyth F, Woolf A, Bain C, et al. The global burden of low back pain: Estimates from the global burden of disease 2010 study. Ann Rheum Dis 2014;73:968-74.
  • 40.Itz CJ, Geurts JW, Van Kleef M, Nelemans P. Clinical course of non-specific low back pain: A systematic review of prospective cohort studies set in primary care. Eur J Pain 2013;17:5-15.
  • 41.Jacobs W, Van der Gaag NA, Tuschel A, De Kleuver M, Peul W, Verbout AJ, et al. Total disc replacement for chronic back pain in the presence of disc degeneration. Cochrane Database Syst Rev 2012;9:CD008326.
  • 42.Jarvik JG, Deyo RA. Diagnostic evaluation of low back pain with emphasis on imaging. Ann Intern Med 2002;137:586-97.
  • 43.Jensen MC, Brant-Zawadzki MN, Obuchowski N, Modic MT, Malkasian D, Ross JS. Magnetic resonance imaging of the lumbar spine in people without back pain. N Engl J Med 1994;331:69-73.
  • 44.Joines JD, McNutt RA, Carey TS, Deyo RA, Rouhani R. Finding cancer in primary care outpatients with low back pain: A comparison of diagnostic strategies. J Gen Intern Med 2001;16:14-23.
  • 45.Kalpakcioglu B, Altinbilek T, Senel K. Determination of spondylolisthesis in low back pain by clinical evaluation. J Back Musculoskelet Rehabil 2009;22:27-32.
  • 46.Kamper SJ, Apeldoorn AT, Chiarotto A, Smeets RJ, Ostelo RW, Guzman J, et al. Multidisciplinary biopsychosocial rehabilitation for chronic low back pain. Cochrane Database Syst Rev 2014;9:CD000963.
  • 47.Khan M, Akhter S, Soomro RR, Ali SS. The effectiveness of cognitive behavioral therapy (CBT) with general exercises versus general exercises alone in the management of chronic low back pain. Pak J Pharm Sci 2014;27:1113-6.
  • 48.KNMP. Informatorium medicamentorum 2015. Den Haag: Koninklijke Nederlandse Maatschappij der bevordering der Pharmacie, 2015.
  • 49.Kuijpers T, Van Middelkoop M, Rubinstein SM, Ostelo R, Verhagen A, Koes BW, et al. A systematic review on the effectiveness of pharmacological interventions for chronic non-specific low-back pain. Eur Spine J 2011;20:40-50.
  • 50.Lamb SE, Mistry D, Lall R, Hansen Z, Evans D, Withers EJ, et al. Group cognitive behavioural interventions for low back pain in primary care: Extended follow-up of the back skills training trial (isrctn54717854). Pain 2012;153:494-501.
  • 51.Lamb SE, Hansen Z, Lall R, Castelnuovo E, Withers EJ, Nichols V, et al. Group cognitive behavioural treatment for low-back pain in primary care: A randomised controlled trial and cost-effectiveness analysis. Lancet 2010;375:916-23.
  • 52.Lambeek LC, Bosmans JE, Van Royen BJ, Van Tulder MW, Van Mechelen W, Anema JR. Effect of integrated care for sick listed patients with chronic low back pain: Economic evaluation alongside a randomised controlled trial. BMJ 2010;341:c6414.
  • 53.Lambeek LC, Van Tulder MW, Swinkels IC, Koppes LL, Anema JR, van MW. The trend in total cost of back pain in the netherlands in the period 2002 to 2007. Spine (Phila Pa 1976.) 2011;36:1050-8.
  • 54.Lang J, Ochsmann E, Kraus T, Lang JW. Psychosocial work stressors as antecedents of musculoskeletal problems: A systematic review and meta-analysis of stability-adjusted longitudinal studies. Soc Sci Med 2012;75:1163-74.
  • 55.Lopez-de-Uralde-Villanueva I, Munoz-Garcia D, Gil-Martinez A, Pardo-Montero J, Munoz-Plata R, Angulo-Diaz-Parreno S, et al. A systematic review and meta-analysis on the effectiveness of graded activity and graded exposure for chronic nonspecific low back pain. Pain Med 2016:17:172-88.
  • 56.Lotters F, Burdorf A, Kuiper J, Miedema H. Model for the work-relatedness of low-back pain. Scand J Work Environ Health 2003;29:431-40.
  • 57.Maas ET, Ostelo RW, Niemisto L, Jousimaa J, Hurri H, Malmivaara A, et al. Radiofrequency denervation for chronic low back pain. Cochrane Database Syst Rev 2015;10:CD008572.
  • 58.Macedo LG, Smeets RJ, Maher CG, Latimer J, McAuley JH. Graded activity and graded exposure for persistent nonspecific low back pain: A systematic review. Phys Ther 2010;90:860-79.
  • 59.May S, Littlewood C, Bishop A. Reliability of procedures used in the physical examination of non-specific low back pain: A systematic review. Aust J Physiother 2006;52:91-102.
  • 60.Mehling WE, Gopisetty V, Bartmess E, Acree M, Pressman A, Goldberg H, et al. The prognosis of acute low back pain in primary care in the united states: A 2-year prospective cohort study. Spine (Phila Pa 1976.) 2012;37:678-84.
  • 61.Monticone M, Ferrante S, Rocca B, Baiardi P, Farra FD, Foti C. Effect of a long-lasting multidisciplinary program on disability and fear-avoidance behaviors in patients with chronic low back pain: Results of a randomized controlled trial. Clin J Pain 2013;29:929-38.
  • 62.Morso L, Kent P, Albert HB, Hill JC, Kongsted A, Manniche C. The predictive and external validity of the start back tool in danish primary care. Eur Spine J 2013;22:1859-67.
  • 63.Muehlbacher M, Nickel MK, Kettler C, Tritt K, Lahmann C, Leiberich PK, et al. Topiramate in treatment of patients with chronic low back pain: A randomized, double-blind, placebo-controlled study. Clin J Pain 2006;22:526-31.
  • 64.NIVEL. Incidenties en prevalenties (2014). www.nivel.nl/nl/nzr/incidenties-en-prevalenties.
  • 65.Nordeman L, Nilsson B, Moller M, Gunnarsson R. Early access to physical therapy treatment for subacute low back pain in primary health care: A prospective randomized clinical trial. Clin J Pain 2006;22:505-11.
  • 66.Oesch P, Kool J, Hagen KB, Bachmann S. Effectiveness of exercise on work disability in patients with non-acute non-specific low back pain: Systematic review and meta-analysis of randomised controlled trials. J Rehabil Med 2010;42:193-205.
  • 67.Opstelten W, Rimmelzwaan GF, van Essen GA, Bijlsma JW. Influenzavaccinatie van patienten met verminderde afweer: Veilig en effectief. Ned Tijdschr Geneeskd 2009;153:A902.
  • 68.Pengel LH, Herbert RD, Maher CG, Refshauge KM. Acute low back pain: Systematic review of its prognosis. BMJ 2003;327:323.
  • 69.Pengel LH, Refshauge KM, Maher CG, Nicholas MK, Herbert RD, McNair P. Physiotherapist-directed exercise, advice, or both for subacute low back pain: A randomized trial. Ann Intern Med 2007;146:787-96.
  • 70.Phillips FM, Slosar PJ, Youssef JA, Andersson G, Papatheofanis F. Lumbar spine fusion for chronic low back pain due to degenerative disc disease: A systematic review. Spine (Phila Pa 1976) 2013;38:E409-22.
  • 71.Punt IM, Cleutjens JP, De Bruin T, Willems PC, Kurtz SM, Van Rhijn LW, et al. Periprosthetic tissue reactions observed at revision of total intervertebral disc arthroplasty. Biomaterials 2009;30:2079-84.
  • 72.Putzier M, Funk JF, Schneider SV, Gross C, Tohtz SW, Khodadadyan-Klostermann C, et al. Charite total disc replacement--clinical and radiographical results after an average follow-up of 17 years. Eur Spine J 2006;15:183-95.
  • 73.Raastad J, Reiman M, Coeytaux R, Ledbetter L, Goode AP. The association between lumbar spine radiographic features and low back pain: A systematic review and meta-analysis. Semin Arthritis Rheum 2015;44:571-85.
  • 74.Ramond A, Bouton C, Richard I, Roquelaure Y, Baufreton C, Legrand E, et al. Psychosocial risk factors for chronic low back pain in primary care--a systematic review. Fam Pract 2011;28:12-21.
  • 75.Richmond H, Hall AM, Copsey B, Hansen Z, Williamson E, Hoxey-Thomas N, et al. The effectiveness of cognitive behavioural treatment for non-specific low back pain: A systematic review and meta-analysis. PLoS One 2015;10:e0134192.
  • 76.Roelofs PD, Deyo RA, Koes BW, Scholten RJ, Van Tulder MW. Non-steroidal anti-inflammatory drugs for low back pain. Cochrane Database Syst Rev 2008:CD000396.
  • 77.Rubinstein SM, Van Tulder M. A best-evidence review of diagnostic procedures for neck and low-back pain. Best Pract Res Clin Rheumatol 2008;22:471-82.
  • 78.Rubinstein SM, Van Middelkoop M, Assendelft WJ, De Boer MR, Van Tulder MW. Spinal manipulative therapy for chronic low-back pain. Cochrane Database Syst Rev 2011:CD008112.
  • 79.Rubinstein SM, Terwee CB, Assendelft WJ, De Boer MR, Van Tulder MW. Spinal manipulative therapy for acute low-back pain. Cochrane Database Syst Rev 2012;9:CD008880.
  • 80.Senna MK, Machaly SA. Does maintained spinal manipulation therapy for chronic nonspecific low back pain result in better long-term outcome? Spine (Phila Pa 1976) 2011;36:1427-37.
  • 81.Shiri R, Karppinen J, Leino-Arjas P, Solovieva S, Viikari-Juntura E. The association between obesity and low back pain: A meta-analysis. Am J Epidemiol 2010a;171:135-54.
  • 82.Shiri R, Karppinen J, Leino-Arjas P, Solovieva S, Viikari-Juntura E. The association between smoking and low back pain: A meta-analysis. Am J Med 2010b;123:87.e7-35.
  • 83.Siemonsma PC, Stuive I, Roorda LD, Vollebregt JA, Walker MF, Lankhorst GJ, et al. Cognitive treatment of illness perceptions in patients with chronic low back pain: A randomized controlled trial. Phys Ther 2013;93:435-48.
  • 84.Smith BE, Littlewood C, May S. An update of stabilisation exercises for low back pain: A systematic review with meta-analysis. BMC Musculoskelet Disord 2014;15:416.
  • 85.Snijders TJ, Notermans NC. Progressieve, opstijgende neurologische uitval: Een spinaal epiduraal abces dat zich presenteert als een syndroom van Guillain-Barre. Ned.Tijdschr.Geneeskd. 2008;152:1436-9.
  • 86.Spijker-Huiges A, Groenhof F, Winters JC, Van Wijhe M, Groenier KH, Van der Meer K. Radiating low back pain in general practice: Incidence, prevalence, diagnosis, and long-term clinical course of illness. Scand J Prim Health Care 2015;33:27-32.
  • 87.Spoorenberg A, Van der Heijde D, De Klerk E, Dougados M, De Vlam K, Mielants H, et al. Relative value of erythrocyte sedimentation rate and C-reactive protein in assessment of disease activity in ankylosing spondylitis. J Rheumatol 1999;26:980-4.
  • 88.Staal JB, De Bie R, De Vet HC, Hildebrandt J, Nelemans P. Injection therapy for subacute and chronic low-back pain. Cochrane Database Syst Rev 2008:CD001824.
  • 89.Steffens D, Hancock MJ, Pereira LS, Kent PM, Latimer J, Maher CG. Do MRI findings identify patients with low back pain or sciatica who respond better to particular interventions? A systematic review. Eur Spine J 2016;25:1170-87.
  • 90.Taylor JB, Goode AP, George SZ, Cook CE. Incidence and risk factors for first-time incident low back pain: A systematic review and meta-analysis. Spine J 2014;14:2299-319.
  • 91.Theus R, Zaat JO, Uijen A, Enzing JJ. Rugpijn: Patienten versus onderzoek. Ned Tijdschr Geneeskd 2014;158:A7456.
  • 92.Ursum J, Spronk I, Davids R, Korevaar JC. Zorggebruik van patiënten met rugpijn in de huisartsenpraktijk (2014). www.nivel.nl/node/3347.
  • 93.Van de Lisdonk EH, Huisman IA. Lage-rugpijn en benzodiazepine: Een relatie vol spanning. Huisarts Wet 1998;41:75-9.
  • 94.Van der Giessen RN, Speksnijder CM, Helders PJ. The effectiveness of graded activity in patients with non-specific low-back pain: A systematic review. Disabil Rehabil 2012;34:1070-6.
  • 95.Van der Horst-Bruinsma IE, Oostveen JCM, Van Denderen JC, De Sonnaville PBJ, Nurmohamed MT, Van Tubergen A, et al. Richtlijn voor de diagnostiek en behandeling van axiale spondyloartritis (2014). www.med-info.nl/Richtlijnen/Bewegingsapparaat/Spondylitis%20ankyloserend.pdf.
  • 96.Van Hoeven L, Luime J, Han H, Vergouwe Y, Weel A. Identifying axial spondyloarthritis in dutch primary care patients, ages 20-45 years, with chronic low back pain. Arthritis Care Res (Hoboken) 2014;66:446-53.
  • 97.Van Hooff M, Van Lankveld W, Anderson P, Apeldoorn A, Van Hartingsveld F, Ostelo R. The start back screening tool: Dutch version. Rugscreeningsinstrument (2011). www.keele.ac.uk/media/keeluniversity/ri/primarycare/startbackmicro/Dutch_tool.pdf.
  • 98.Van Middelkoop M, Rubinstein SM, Kuijpers T, Verhagen AP, Ostelo R, Koes BW, et al. A systematic review on the effectiveness of physical and rehabilitation interventions for chronic non-specific low back pain. Eur Spine J 2011;20:19-39.
  • 99.Van Ooij A, Oner FC, Verbout AJ. Complications of artificial disc replacement: A report of 27 patients with the SB Charité disc. J Spinal Disord Tech 2003;16:369-83.
  • 100.Van Oostrom SH, Monique Verschuren WM, De Vet HC, Picavet HS. Ten year course of low back pain in an adult population-based cohort-the Doetinchem cohort study. Eur J Pain 2011;15:993-8.
  • 101.Van Tulder MW, Touray T, Furlan AD, Solway S, Bouter LM. Muscle relaxants for non-specific low back pain. Cochrane Database Syst Rev 2003:CD004252.
  • 102.Van Tulder MW, Koes BW. Evidence-based handelen bij lage rugpijn. Epidemiologie, preventie, diagnostiek, behandeling en richtlijnen. Houten: Bohn Stafleu van Loghum, 2013a.
  • 103.Van Tulder MW, Koes BW. Ketenzorgrichtlijn aspecifieke lage rugklachten. Epidemiologie, preventie, diagnostiek, behandeling en richtlijnen. Houten: Bohn Stafleu van Loghum, 2013b.
  • 104.Vibe Fersum K, O’Sullivan P, Skouen JS, Smith A, Kvale A. Efficacy of classification-based cognitive functional therapy in patients with non-specific chronic low back pain: A randomized controlled trial. Eur J Pain 2013;17:916-28.
  • 105.Wang X, Wanyan P, Tian JH, Hu L. Meta-analysis of randomized trials comparing fusion surgery to non-surgical treatment for discogenic chronic low back pain. J Back Musculoskelet Rehabil 2015;28:621-7.
  • 106.Watters WC, 3rd, Bono CM, Gilbert TJ, Kreiner DS, Mazanec DJ, Shaffer WO, et al. An evidence-based clinical guideline for the diagnosis and treatment of degenerative lumbar spondylolisthesis. Spine J 2009;9:609-14.
  • 107.Webster BS, Verma SK, Gatchel RJ. Relationship between early opioid prescribing for acute occupational low back pain and disability duration, medical costs, subsequent surgery and late opioid use. Spine (Phila Pa 1976) 2007;32:2127-32.
  • 108.Williams CM, Maher CG, Latimer J, McLachlan AJ, Hancock MJ, Day RO, et al. Efficacy of paracetamol for acute low-back pain: A double-blind, randomised controlled trial. Lancet 2014;384:1586-96.
  • 109.Yamato TP, Maher CG, Saragiotto BT, Hancock MJ, Ostelo RW, Cabral CM, et al. Pilates for low back pain: Complete republication of a cochrane review. Spine (Phila Pa 1976) 2015;41:1013-21.
  • 110.You JJ, Bederman SS, Symons S, Bell CM, Yun L, Laupacis A, et al. Patterns of care after magnetic resonance imaging of the spine in primary care. Spine (Phila Pa 1976) 2013;38:51-9.

Reacties

Er zijn nog geen reacties

Verder lezen